Name | KIF5C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3465 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ |
Purity/Format | Affinity purified |
Blocking Peptide | KIF5C Blocking Peptide |
Description | Rabbit polyclonal KIF5C antibody raised against the N terminal of KIF5C |
Gene | KIF5A |
Supplier Page | Shop |