KIF5C antibody

Name KIF5C antibody
Supplier Fitzgerald
Catalog 70R-3465
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ
Purity/Format Affinity purified
Blocking Peptide KIF5C Blocking Peptide
Description Rabbit polyclonal KIF5C antibody raised against the N terminal of KIF5C
Gene KIF5A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.