| Name | SOCS7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5835 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP |
| Purity/Format | Affinity purified |
| Blocking Peptide | SOCS7 Blocking Peptide |
| Description | Rabbit polyclonal SOCS7 antibody raised against the N terminal of SOCS7 |
| Gene | SOCS4 |
| Supplier Page | Shop |