| Name | XRN1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4745 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM |
| Purity/Format | Affinity purified |
| Blocking Peptide | XRN1 Blocking Peptide |
| Description | Rabbit polyclonal XRN1 antibody raised against the middle region of XRN1 |
| Gene | XRN1 |
| Supplier Page | Shop |