Name | POSTN antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6070 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | POSTN antibody was raised using the middle region of POSTN corresponding to a region with amino acids VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ |
Purity/Format | Affinity purified |
Blocking Peptide | POSTN Blocking Peptide |
Description | Rabbit polyclonal POSTN antibody raised against the middle region of POSTN |
Gene | POSTN |
Supplier Page | Shop |