| Name | RNF19A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6263 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF19A Blocking Peptide |
| Description | Rabbit polyclonal RNF19A antibody raised against the N terminal of RNF19A |
| Gene | RNF19A |
| Supplier Page | Shop |