| Name | MCM3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5515 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE |
| Purity/Format | Affinity purified |
| Blocking Peptide | MCM3 Blocking Peptide |
| Description | Rabbit polyclonal MCM3 antibody raised against the C terminal of MCM3 |
| Gene | MCM3 |
| Supplier Page | Shop |