| Name | NONO antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1316 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NONO Blocking Peptide |
| Description | Rabbit polyclonal NONO antibody raised against the C terminal of NONO |
| Gene | NONO |
| Supplier Page | Shop |