| Name | ACPP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5707 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACPP Blocking Peptide |
| Description | Rabbit polyclonal ACPP antibody raised against the middle region of ACPP |
| Gene | ACPP |
| Supplier Page | Shop |