| Name | OSMR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7385 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH |
| Purity/Format | Affinity purified |
| Blocking Peptide | OSMR Blocking Peptide |
| Description | Rabbit polyclonal OSMR antibody raised against the middle region of OSMR |
| Gene | OSMR |
| Supplier Page | Shop |