| Name | SFRS6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4617 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS |
| Purity/Format | Affinity purified |
| Blocking Peptide | SFRS6 Blocking Peptide |
| Description | Rabbit polyclonal SFRS6 antibody raised against the middle region of SFRS6 |
| Gene | SRSF6 |
| Supplier Page | Shop |