| Name | LFNG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6332 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK |
| Purity/Format | Affinity purified |
| Blocking Peptide | LFNG Blocking Peptide |
| Description | Rabbit polyclonal LFNG antibody raised against the N terminal of LFNG |
| Gene | LFNG |
| Supplier Page | Shop |