| Name | CYP4A22 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6524 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | CYP4A22 antibody was raised using the N terminal of CYP4A22 corresponding to a region with amino acids MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | CYP4A22 Blocking Peptide |
| Description | Rabbit polyclonal CYP4A22 antibody raised against the N terminal of CYP4A22 |
| Gene | CYP4A22 |
| Supplier Page | Shop |