| Name | MTR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5231 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MTR Blocking Peptide |
| Description | Rabbit polyclonal MTR antibody raised against the C terminal of MTR |
| Gene | MTR |
| Supplier Page | Shop |