| Name | COPA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6204 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD |
| Purity/Format | Affinity purified |
| Blocking Peptide | COPA Blocking Peptide |
| Description | Rabbit polyclonal COPA antibody raised against the N terminal of COPA |
| Gene | COPA |
| Supplier Page | Shop |