| Name | RRAGC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3630 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | RRAGC Blocking Peptide |
| Description | Rabbit polyclonal RRAGC antibody raised against the N terminal of RRAGC |
| Gene | RRAGC |
| Supplier Page | Shop |