| Name | CALCRL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6003 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | CALCRL Blocking Peptide |
| Description | Rabbit polyclonal Calcitonin Receptor-Like antibody raised against the N terminal of CALCRL |
| Gene | CALCRL |
| Supplier Page | Shop |