| Name | UBE2L3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3085 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBE2L3 Blocking Peptide |
| Description | Rabbit polyclonal UBE2L3 antibody raised against the C terminal of UBE2L3 |
| Gene | UBE2L3 |
| Supplier Page | Shop |