NIT1 antibody

Name NIT1 antibody
Supplier Fitzgerald
Catalog 70R-2732
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
Purity/Format Affinity purified
Blocking Peptide NIT1 Blocking Peptide
Description Rabbit polyclonal NIT1 antibody raised against the N terminal of NIT1
Gene NIT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.