| Name | EDG8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6973 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI |
| Purity/Format | Affinity purified |
| Blocking Peptide | EDG8 Blocking Peptide |
| Description | Rabbit polyclonal EDG8 antibody raised against the N terminal of EDG8 |
| Gene | S1PR5 |
| Supplier Page | Shop |