RAD23B antibody

Name RAD23B antibody
Supplier Fitzgerald
Catalog 70R-3309
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG
Purity/Format Affinity purified
Blocking Peptide RAD23B Blocking Peptide
Description Rabbit polyclonal RAD23B antibody
Gene RAD23B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.