Eph Receptor A5 antibody

Name Eph Receptor A5 antibody
Supplier Fitzgerald
Catalog 70R-2219
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
Purity/Format Affinity purified
Blocking Peptide Eph Receptor A5 Blocking Peptide
Description Rabbit polyclonal Eph Receptor A5 antibody raised against the middle region of EPHA5
Gene EPHA5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.