Name | FNTA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2956 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FNTA antibody was raised using the N terminal of FNTA corresponding to a region with amino acids MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASP |
Purity/Format | Affinity purified |
Blocking Peptide | FNTA Blocking Peptide |
Description | Rabbit polyclonal FNTA antibody raised against the N terminal of FNTA |
Gene | FNTA |
Supplier Page | Shop |