FNTA antibody

Name FNTA antibody
Supplier Fitzgerald
Catalog 70R-2956
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FNTA antibody was raised using the N terminal of FNTA corresponding to a region with amino acids MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASP
Purity/Format Affinity purified
Blocking Peptide FNTA Blocking Peptide
Description Rabbit polyclonal FNTA antibody raised against the N terminal of FNTA
Gene FNTA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.