| Name | RBM22 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4782 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM22 Blocking Peptide |
| Description | Rabbit polyclonal RBM22 antibody raised against the C terminal of RBM22 |
| Gene | RBM22 |
| Supplier Page | Shop |