Name | KCNK6 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5203 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK |
Purity/Format | Affinity purified |
Blocking Peptide | KCNK6 Blocking Peptide |
Description | Rabbit polyclonal KCNK6 antibody raised against the n terminal of KCNK6 |
Gene | KCNK6 |
Supplier Page | Shop |