| Name | MAT2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3571 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MAT2B antibody was raised using the N terminal of MAT2B corresponding to a region with amino acids KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAT2B Blocking Peptide |
| Description | Rabbit polyclonal MAT2B antibody raised against the N terminal of MAT2B |
| Gene | MAT2B |
| Supplier Page | Shop |