| Name | ORC4L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5589 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ORC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ORC4L Blocking Peptide |
| Description | Rabbit polyclonal ORC4L antibody |
| Gene | ORC4 |
| Supplier Page | Shop |