| Name | HERC4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2128 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | HERC4 Blocking Peptide |
| Description | Rabbit polyclonal HERC4 antibody raised against the n terminal of HERC4 |
| Gene | HERC4 |
| Supplier Page | Shop |