UBE2J1 antibody

Name UBE2J1 antibody
Supplier Fitzgerald
Catalog 70R-1776
Prices $315.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse
Antigen UBE2J1 antibody was raised using a synthetic peptide corresponding to a region with amino acids METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD
Purity/Format Total IgG Protein A purified
Blocking Peptide UBE2J1 Blocking Peptide
Description Rabbit polyclonal UBE2J1 antibody
Gene UBE2J1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.