ICA1L antibody

• Supplier: Fitzgerald
• Catalog: 70R-4147
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat
• Antigen: ICA1L antibody was raised using the middle region of ICA1L corresponding to a region with amino acids PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA
• Purity/Format: Affinity purified
• Blocking Peptide: ICA1L Blocking Peptide
• Description: Rabbit polyclonal ICA1L antibody raised against the middle region of ICA1L
• Gene: ICA1