AOC2 antibody (retina specific)

Name AOC2 antibody (retina specific)
Supplier Fitzgerald
Catalog 70R-7299
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN
Purity/Format Affinity purified
Blocking Peptide AOC2 Blocking Peptide (retina specific)
Description Rabbit polyclonal AOC2 antibody (retina specific)
Gene AOC2
Conjugate retina specific
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.