| Name | RAB5A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5813 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB5A Blocking Peptide |
| Description | Rabbit polyclonal RAB5A antibody raised against the middle region of RAB5A |
| Gene | RAB5A |
| Supplier Page | Shop |