Name | CD40 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6008 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Purity/Format | Affinity purified |
Blocking Peptide | CD40 Blocking Peptide |
Description | Rabbit polyclonal CD40 antibody raised against the N terminal of CD40 |
Gene | CD40 |
Supplier Page | Shop |