| Name | KARS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4755 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV |
| Purity/Format | Affinity purified |
| Blocking Peptide | KARS Blocking Peptide |
| Description | Rabbit polyclonal KARS antibody raised against the C terminal of KARS |
| Gene | KARS |
| Supplier Page | Shop |