PTPN1 antibody

Name PTPN1 antibody
Supplier Fitzgerald
Catalog 70R-6625
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PTPN1 antibody was raised using the middle region of PTPN1 corresponding to a region with amino acids SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL
Purity/Format Affinity purified
Blocking Peptide PTPN1 Blocking Peptide
Description Rabbit polyclonal PTPN1 antibody raised against the middle region of PTPN1
Gene PTPN1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.