| Name | GSPT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3859 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GSPT2 antibody was raised using the middle region of GSPT2 corresponding to a region with amino acids GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT |
| Purity/Format | Affinity purified |
| Blocking Peptide | GSPT2 Blocking Peptide |
| Description | Rabbit polyclonal GSPT2 antibody raised against the middle region of GSPT2 |
| Gene | GSPT2 |
| Supplier Page | Shop |