| Name | Mucolipin 1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5139 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
| Purity/Format | Affinity purified |
| Blocking Peptide | Mucolipin 1 Blocking Peptide |
| Description | Rabbit polyclonal Mucolipin 1 antibody raised against the N terminal of MCOLN1 |
| Gene | MCOLN1 |
| Supplier Page | Shop |