Name | CYP4F11 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1872 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CYP4F11 antibody was raised using the N terminal of CYP4F11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CYP4F11 Blocking Peptide |
Description | Rabbit polyclonal CYP4F11 antibody raised against the N terminal of CYP4F11 |
Gene | CYP4F11 |
Supplier Page | Shop |