CYP4F11 antibody

Name CYP4F11 antibody
Supplier Fitzgerald
Catalog 70R-1872
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CYP4F11 antibody was raised using the N terminal of CYP4F11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI
Purity/Format Total IgG Protein A purified
Blocking Peptide CYP4F11 Blocking Peptide
Description Rabbit polyclonal CYP4F11 antibody raised against the N terminal of CYP4F11
Gene CYP4F11
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.