HERC5 antibody

• Supplier: Fitzgerald
• Catalog: 70R-5525
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: HERC5 antibody was raised using the middle region of HERC5 corresponding to a region with amino acids FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
• Purity/Format: Affinity purified
• Blocking Peptide: HERC5 Blocking Peptide
• Description: Rabbit polyclonal HERC5 antibody raised against the middle region of HERC5
• Gene: HERC5