GPR75 antibody

Name GPR75 antibody
Supplier Fitzgerald
Catalog 70R-6305
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS
Purity/Format Affinity purified
Blocking Peptide GPR75 Blocking Peptide
Description Rabbit polyclonal GPR75 antibody raised against the middle region of GPR75
Gene GPR75
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.