| Name | WARS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2448 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF |
| Purity/Format | Affinity purified |
| Blocking Peptide | WARS Blocking Peptide |
| Description | Rabbit polyclonal WARS antibody raised against the N terminal of WARS |
| Gene | WARS |
| Supplier Page | Shop |