| Name | HIST2H2BF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2096 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HIST2H2BF antibody was raised using the N terminal of HIST2H2BF corresponding to a region with amino acids MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH |
| Purity/Format | Affinity purified |
| Blocking Peptide | HIST2H2BF Blocking Peptide |
| Description | Rabbit polyclonal HIST2H2BF antibody raised against the N terminal of HIST2H2BF |
| Gene | HIST2H2BF |
| Supplier Page | Shop |