SIGLEC12 antibody

Name SIGLEC12 antibody
Supplier Fitzgerald
Catalog 70R-6150
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE
Purity/Format Affinity purified
Blocking Peptide SIGLEC12 Blocking Peptide
Description Rabbit polyclonal SIGLEC12 antibody raised against the N terminal of SIGLEC12
Gene SIGLEC12
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.