| Name | FNTA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1202 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FNTA Blocking Peptide |
| Description | Rabbit polyclonal FNTA antibody raised against the C terminal of FNTA |
| Gene | FNTA |
| Supplier Page | Shop |