| Name | PTHLH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1717 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PTHLH Blocking Peptide |
| Description | Rabbit polyclonal PTHLH antibody raised against the middle region of PTHLH |
| Gene | PTHLH |
| Supplier Page | Shop |