NMNAT1 antibody

Name NMNAT1 antibody
Supplier Fitzgerald
Catalog 70R-1042
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL
Purity/Format Total IgG Protein A purified
Blocking Peptide NMNAT1 Blocking Peptide
Description Rabbit polyclonal NMNAT1 antibody raised against the N terminal of NMNAT1
Gene NMNAT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.