| Name | PDIA6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5434 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDIA6 Blocking Peptide |
| Description | Rabbit polyclonal PDIA6 antibody raised against the N terminal of PDIA6 |
| Gene | PDIA6 |
| Supplier Page | Shop |