| Name | TPRKB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4344 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TPRKB antibody was raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | TPRKB Blocking Peptide |
| Description | Rabbit polyclonal TPRKB antibody raised against the middle region of TPRKB |
| Gene | TPRKB |
| Supplier Page | Shop |