| Name | HHAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7304 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | HHAT antibody was raised using the N terminal of HHAT corresponding to a region with amino acids MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HHAT Blocking Peptide |
| Description | Rabbit polyclonal HHAT antibody raised against the N terminal of HHAT |
| Gene | SIT1 |
| Supplier Page | Shop |