MSI2 antibody

Name MSI2 antibody
Supplier Fitzgerald
Catalog 70R-4920
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM
Purity/Format Affinity purified
Blocking Peptide MSI2 Blocking Peptide
Description Rabbit polyclonal MSI2 antibody
Gene MSI2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.