| Name | ALKBH8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1459 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ALKBH8 Blocking Peptide |
| Description | Rabbit polyclonal ALKBH8 antibody |
| Gene | ALKBH3 |
| Supplier Page | Shop |